Overview

  • Product nameHuman NFYB full length protein
  • DescriptionHuman NFYB full length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP25208
    • SpeciesHuman
    • SequenceMTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKE SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSE ASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG IGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS
    • Molecular weight49 kDa including tags
    • Amino acids1 to 207

Specifications

Our Abpromise guarantee covers the use of ab114919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional NotesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General info

  • Alternative names
    • CAAT box DNA binding protein subunit B
    • CAAT box DNA-binding protein subunit B
    • CBF A
    • CBF B
    • CCAAT binding transcription factor subunit A
    • HAP 3
    • HAP3
    • NF Y protein chain B
    • NF YB
    • NF-YB
    • NFYB
    • NFYB_HUMAN
    • Nuclear transcription factor Y beta
    • Nuclear transcription factor Y subunit B
    • Nuclear transcription factor Y subunit beta
    • Transcription factor NF Y B subunit
    see all
  • FunctionStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similaritiesBelongs to the NFYB/HAP3 subunit family.
  • DomainCan be divided into 3 domains: the weakly conserved A domain, the highly conserved B domain thought to be involved in subunit interaction and DNA binding, and the Glu-rich C domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Human NFYB full length protein images

  • 12.5% SDS-PAGE showing ab114919 at approximately 48.51kDa.
    Stained with Coomassie Blue.

References for Human NFYB full length protein (ab114919)

ab114919 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"