Human NKIRAS1 full length protein (ab123143)

Overview

  • Product nameHuman NKIRAS1 full length protein
  • DescriptionHuman NKIRAS1 full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ9NYS0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHT IGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFAD GFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQV DAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLP GRKNKGNSNSEN
    • Molecular weight24 kDa including tags
    • Amino acids1 to 192
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab123143 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol

General info

  • Alternative names
    • 2400004O09Rik
    • I kappa B interacting Ras like protein 1
    • I-kappa-B-interacting Ras-like protein 1
    • Kappa B Ras 1
    • Kappa B Ras protein 1
    • Kappa B-Ras protein 1
    • KappaB Ras1
    • KappaB-Ras1
    • KBRAS 1
    • KBRAS1
    • KBRS1_HUMAN
    • NF kappa B inhibitor interacting Ras like protein 1
    • NF-kappa-B inhibitor-interacting Ras-like protein 1
    • NFKB inhibitor interacting Ras like 1
    • NFKB inhibitor interacting Ras like protein 1
    • NKIRAS 1
    • nkiras1
    see all
  • FunctionAtypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.
  • DomainIn contrast to other members of the Ras family, the members of the KappaB-Ras subfamily do not contain the conserved Gly and Gln residues in positions 13 and 65, which are replaced by Leu residues, and are therefore similar to the constitutively active forms of oncogenic forms of Ras. This suggests that members of this family are clearly different from other small GTPases proteins.
  • Cellular localizationCytoplasm.
  • Target information above from: UniProt accession Q9NYS0 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human NKIRAS1 full length protein images

  • 12% SDS PAGE, 3 µg of ab123143 loaded.

References for Human NKIRAS1 full length protein (ab123143)

ab123143 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"