Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTEL
    • Amino acids
      181 to 230

Specifications

Our Abpromise guarantee covers the use of ab95915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: dH2O

General Info

  • Alternative names
    • ATP receptor
    • MGC129601
    • P2RX 2
    • P2RX2
    • P2RX2_HUMAN
    • P2X purinoceptor 2
    • P2X Receptor subunit 2
    • P2X2
    • P2X2a
    • Purinergic receptor
    • Purinergic receptor P2X ligand gated ion channel 2
    • Purinergic receptor P2X2 isoform A
    • Purinergic receptor P2X2 isoform B
    • Purinergic receptor P2X2 isoform C
    • Purinergic receptor P2X2 isoform D
    • Purinergic receptor P2X2 isoform H
    • Purinergic receptor P2X2 isoform I
    see all
  • Function
    Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle.
  • Involvement in disease
    Deafness, autosomal dominant, 41
  • Sequence similarities
    Belongs to the P2X receptor family.
  • Cellular localization
    Cell membrane. Localizes to the apical membranes of hair cells in the organ of Corti.
  • Information by UniProt

References for Human P2X2 peptide (ab95915)

ab95915 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab95915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up