Human Parathyroid Hormone peptide (ab42334)

Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
    • Amino acids
      1 to 34

Associated products

Specifications

Our Abpromise guarantee covers the use of ab42334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None

General Info

  • Alternative names
    • hPTH
    • Parathormone
    • Parathyrin
    • Parathyroid hormone
    • Parathyroid hormone 1
    • Prepro PTH
    • Preproparathyroid hormone
    • PTH
    • PTH1
    • PTH1 receptor
    • PTH1R
    • PTHR
    • PTHR1
    • PTHY_HUMAN
    see all
  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Human Parathyroid Hormone peptide (ab42334)

ab42334 has not yet been referenced specifically in any publications.

Product Wall

DISCOUNT CODE: XXXXXXXXXX
Expiration date: 09/09/2012

I am very pleased to hear you would like to accept our offer and test ab85205 in [Rat]. This code will give you: 1 free [PRIMARY ANTIBODY/PROTEIN] OR VALUE OFF OF ORDER before the ex...

Read More

Thank you for contacting us.

The immunogen sequence of ab85205 is 100% similar to rat parathyroid hormone related protein so it is more likely that this antibody will be able to detect the protein.

This antibody is eligible for 100...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up