Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15055
    • SpeciesHuman
    • SequenceMNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTG RDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
    • Molecular weight37 kDa including tags
    • Amino acids1 to 100

Specifications

Our Abpromise guarantee covers the use of ab112382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityUseful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional Notesab112382 is best used within three months from the date of receiptUseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General info

  • Alternative names
    • Circadian clock protein PERIOD 2
    • FASPS
    • FASPS1
    • hPER 2
    • hPER2
    • KIAA0347
    • OTTHUMP00000164476
    • PER 2
    • PER2
    • PER2_HUMAN
    • Period 2
    • Period 2 isoform 1
    • Period circadian clock 2
    • Period circadian protein 2
    • Period circadian protein homolog 2
    • Period homolog 2
    • Period homolog 2 (Drosophila)
    • Period2
    see all
  • FunctionComponent of the circadian clock mechanism which is essential for generating circadian rhythms. Negative element in the circadian transcriptional loop. Influences clock function by interacting with other circadian regulatory proteins and transporting them to the nucleus. Negatively regulates CLOCK
    NPAS2-BMAL1
    BMAL2-induced transactivation.
  • Tissue specificityWidely expressed. Found in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. High levels in skeletal muscle and pancreas. Low level in lung.
  • Involvement in diseaseDefects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) [MIM:604348]. FASPS is characterized by very early sleep onset and offset. Individuals are 'morning larks' with a 4 hours advance of the sleep, temperature and melatonin rhythms.
  • Sequence similaritiesContains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Post-translational
    modifications
    Phosphorylated by CSNK1E and CSNK1D. Phosphorylation results in PER2 protein degradation.
  • Cellular localizationNucleus. Cytoplasm. Mainly nuclear. Nucleocytoplasmic shuttling is effected by interaction with other circadian core oscillator proteins and/or by phosphorylation. Retention of PER1 in the cytoplasm occurs through PER1-PER2 heterodimer formation or by interaction with CSNK1E and/or phosphorylation which appears to mask the PER nuclear localization signal. Also translocated to the nucleus by CRY1 or CRY2.
  • Target information above from: UniProt accession O15055 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human PER2 protein fragment images

  • ab112382 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Human PER2 protein fragment (ab112382)

ab112382 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"