Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ00169
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEAS KNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGA LNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEP EAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQE LVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFC WLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
    • Molecular weight34 kDa including tags
    • Amino acids1 to 270
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % by SDS-PAGE.
    ab101666 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General info

  • Alternative names
    • MGC99649
    • Phosphatidylinositol transfer protein
    • Phosphatidylinositol transfer protein alpha
    • Phosphatidylinositol transfer protein alpha isoform
    • Phosphotidylinositol transfer protein
    • PI TP alpha
    • PI-TP-alpha
    • PIPNA_HUMAN
    • PITP alpha
    • PITPNA
    • PITPNB
    • PtdIns transfer protein alpha
    • PtdInsTP
    • PtdInsTP alpha
    • Vb
    • VIB1A
    • Vibrator
    see all
  • FunctionCatalyzes the transfer of PtdIns and phosphatidylcholine between membranes.
  • Tissue specificityExpressed in a wide range of tissues.
  • Sequence similaritiesBelongs to the PtdIns transfer protein family. PI transfer class I subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Human PITPN full length protein images

  • 15% SDS-PAGE analysis of 3µg ab101666.

References for Human PITPN full length protein (ab101666)

ab101666 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"