Recombinant Human PLGF protein (ab84148)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human PLGF protein
See all PLGF proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALER LVDVVSEYP SEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQ LLKIRSGDR PSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab84148 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
General Info
-
Alternative names
- D12S1900
- Pgf
- PGFL
see all -
Function
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. -
Tissue specificity
While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Domain
Isoform PlGF-2 contains a basic insert which acts as a cell retention signal. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin. - Information by UniProt
Images
-
Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MW and pI of the protein. -
1D SDS-PAGE of ab84148 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab84148
Lane 2: ab84148 treated with PNGase F to remove potential N-linked glycans
Lane 3: ab84148 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
10μg protein loaded per lane; Deep Purple™ stained. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab84148 has not yet been referenced specifically in any publications.