Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALER LVDVVSEYP SEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQ LLKIRSGDR PSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab84148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • D12S1900
    • PGF
    • PGFL
    • PIGF
    • Placenta growth factor
    • Placental growth factor
    • Placental growth factor, vascular endothelial growth factor related protein
    • PLGF
    • PlGF 2
    • PLGF_HUMAN
    • PlGF2
    • SHGC 10760
    see all
  • FunctionGrowth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner.
  • Tissue specificityWhile the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
  • Sequence similaritiesBelongs to the PDGF/VEGF growth factor family.
  • DomainIsoform PlGF-2 contains a basic insert which acts as a cell retention signal.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationSecreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
  • Information by UniProt

Human PLGF full length protein images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab84148 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab84148
    Lane 2: ab84148 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab84148 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    10µg protein loaded per lane; Deep Purple™ stained.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.

References for Human PLGF full length protein (ab84148)

ab84148 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"