Overview

  • Product name
    Human PRDM9 peptide

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPPK
    • Amino acids
      432 to 481

Specifications

Our Abpromise guarantee covers the use of ab87806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • EC 2.1.1.43
    • Histone lysine N methyltransferase PRDM9
    • Histone-lysine N-methyltransferase PRDM9
    • MEISETZ
    • PFM6
    • PR domain containing 9
    • PR domain containing protein 9
    • PR domain zinc finger protein 9
    • PR domain-containing protein 9
    • PRDM 9
    • PRDM9
    • PRDM9_HUMAN
    see all
  • Function
    Histone methyltransferase that specifically trimethylates 'Lys-4' of histone H3 during meiotic prophase and is essential for proper meiotic progression. Does not have the ability to mono- and dimethylate 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes during early meiotic prophase.
  • Sequence similarities
    Contains 14 C2H2-type zinc fingers.
    Contains 1 KRAB-related domain.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

References for Human PRDM9 peptide (ab87806)

ab87806 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up