Overview

  • Product name
    Human PRDM9 peptide

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPPK
    • Amino acids
      432 to 481

Specifications

Our Abpromise guarantee covers the use of ab87806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • EC 2.1.1.43
    • Histone lysine N methyltransferase PRDM9
    • Histone-lysine N-methyltransferase PRDM9
    • MEISETZ
    • PFM6
    • PR domain containing 9
    • PR domain containing protein 9
    • PR domain zinc finger protein 9
    • PR domain-containing protein 9
    • PRDM 9
    • PRDM9
    • PRDM9_HUMAN
    see all
  • Function
    Histone methyltransferase that specifically trimethylates 'Lys-4' of histone H3 during meiotic prophase and is essential for proper meiotic progression. Does not have the ability to mono- and dimethylate 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes during early meiotic prophase.
  • Sequence similarities
    Contains 14 C2H2-type zinc fingers.
    Contains 1 KRAB-related domain.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

References

ab87806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up