Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NPMYNAVSNADLMDFKNLLDHLEEKMPLED
    • Amino acids
      1 to 30

Specifications

Our Abpromise guarantee covers the use of ab42236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 0.1% Acetic acid

  • Reconstitution
    Resuspend in 0.1% acetic acid for required concentration (vial content is 0.1 mg)

General Info

  • Alternative names
    • ANF
    • ANF_HUMAN
    • ANP
    • ATFB6
    • Atrial natriuretic factor
    • Atrial natriuretic peptide
    • Atriopeptin
    • ATRST2
    • Cardiodilatin
    • Cardiodilatin-related peptide
    • Cardionatrin
    • CDD
    • CDD ANF
    • CDD-ANF
    • CDP
    • Natriuretic peptide A
    • Natriuretic peptide precursor A
    • Natriuretic peptides A
    • NPPA
    • PND
    • Prepronatriodilatin
    • Pronatriodilatin
    see all
  • Function
    Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
  • Involvement in disease
    Atrial standstill 2
    Atrial fibrillation, familial, 6
  • Sequence similarities
    Belongs to the natriuretic peptide family.
  • Post-translational
    modifications
    Cleaved by CORIN upon secretion to produce the functional hormone.
    Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Human proANP peptide (ab42236)

ab42236 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab42236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up