Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ9H0T7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAQAHRTPQPRAAPSQPRVFKLVLLGSGSV GKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLEIWDTAGQEKY HSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLV GNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQEL LQRSDEEGQALRGDAAVALNKGPARQAKCCAH
    • Molecular weight26 kDa
    • Amino acids1 to 212
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % by SDS-PAGE.
    ab109833 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 30% Glycerol, 0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT

General info

  • Alternative names
    • AW413472
    • FLJ12538
    • OTTHUMP00000164417
    • OTTHUMP00000202805
    • Rab 17
    • Rab17
    • RAB17 member RAS oncogene family
    • RAB17_HUMAN
    • Ras related protein Rab 17
    • Ras related protein Rab17
    • Ras-related protein Rab-17
    see all
  • FunctionMight be involved in transcellular transport.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane.
  • Target information above from: UniProt accession Q9H0T7 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human Rab17 full length protein images

  • 15% SDS-PAGE image, ab109833 used at 3ug

References for Human Rab17 full length protein (ab109833)

ab109833 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"