Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
    • Amino acids
      168 to 217

Associated products

Specifications

Our Abpromise guarantee covers the use of ab178834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-RIP3 antibody (ab56164)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

General Info

  • Alternative names
    • Receptor interacting protein 3
    • Receptor interacting serine threonine kinase 3
    • Receptor interacting serine/threonine protein kinase 3
    • Receptor-interacting protein 3
    • Receptor-interacting serine/threonine-protein kinase 3
    • RIP 3
    • RIP like protein kinase 3
    • RIP-3
    • RIP-like protein kinase 3
    • RIPK 3
    • RIPK3
    • RIPK3_HUMAN
    see all
  • Function
    Promotes apoptosis.
  • Tissue specificity
    Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab178834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up