Overview

  • Product name
    Human SLC5A4 peptide

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTN
    • Amino acids
      1 to 50

Specifications

Our Abpromise guarantee covers the use of ab81335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • DJ90G24.4
    • Low affinity sodium glucose cotransporter
    • Na(+)/glucose cotransporter 3
    • SAAT1
    • SGLT2
    • SGLT3
    • Sodium/glucose cotransporter 3
    • Solute carrier family 5 member 4
    see all
  • Relevance
    SLC5A4 is a sodium dependent low affinity glucose cotransporter.
  • Cellular localization
    Multipass membrane protein

References

ab81335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up