Overview

  • Product name
    Human SLC5A4 peptide

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTN
    • Amino acids
      1 to 50

Specifications

Our Abpromise guarantee covers the use of ab81335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • DJ90G24.4
    • Low affinity sodium glucose cotransporter
    • Na(+)/glucose cotransporter 3
    • SAAT1
    • SGLT2
    • SGLT3
    • Sodium/glucose cotransporter 3
    • Solute carrier family 5 member 4
    see all
  • Relevance
    SLC5A4 is a sodium dependent low affinity glucose cotransporter.
  • Cellular localization
    Multipass membrane protein

References for Human SLC5A4 peptide (ab81335)

ab81335 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up