Human SOD2/MnSOD protein (His tag) (ab221330)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALA KGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRD FGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTT GLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
    • Molecular weight
      23 kDa including tags
    • Amino acids
      25 to 222
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein. (AAH12423).

Specifications

Our Abpromise guarantee covers the use of ab221330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Indophenoloxidase B
    • IPO B
    • IPOB
    • Manganese containing superoxide dismutase
    • Manganese SOD
    • Manganese superoxide dismutase
    • Mangano superoxide dismutase
    • Mn SOD
    • Mn superoxide dismutase
    • MNSOD
    • MVCD6
    • SOD 2
    • SOD2
    • SODM_HUMAN
    • Superoxide dismutase [Mn] mitochondrial
    • Superoxide dismutase [Mn], mitochondrial
    • Superoxide dismutase 2 mitochondrial
    see all
  • Function
    Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
  • Involvement in disease
    Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities
    Belongs to the iron/manganese superoxide dismutase family.
  • Post-translational
    modifications
    Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221330 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 27 kDa in SDS-PAGE.

References

ab221330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up