Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
    • Amino acids
      702 to 751

Associated products

Specifications

Our Abpromise guarantee covers the use of ab104436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-SOX5 antibody (ab26041)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: dH2O

General Info

  • Alternative names
    • L SOX5
    • MGC35153
    • Sex determining region Y box 5
    • SOX 5
    • SOX 5 protein
    • Sox5
    • SOX5 protein
    • SOX5_HUMAN
    • SRY (sex determining region Y) box 5
    • SRY box 5
    • Transcription factor SOX 5
    • Transcription factor SOX-5
    • Transcription factor SOX5
    see all
  • Function
    Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro.
  • Sequence similarities
    Contains 1 HMG box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab104436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up