Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
    • Amino acids
      702 to 751

Associated products

Specifications

Our Abpromise guarantee covers the use of ab104436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-SOX5 antibody (ab26041)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: dH2O

General Info

  • Alternative names
    • L SOX5
    • MGC35153
    • Sex determining region Y box 5
    • SOX 5
    • SOX 5 protein
    • Sox5
    • SOX5 protein
    • SOX5_HUMAN
    • SRY (sex determining region Y) box 5
    • SRY box 5
    • Transcription factor SOX 5
    • Transcription factor SOX-5
    • Transcription factor SOX5
    see all
  • Function
    Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro.
  • Sequence similarities
    Contains 1 HMG box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References for Human SOX5 peptide (ab104436)

ab104436 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up