Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-Staufen antibody (ab50914)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • Double stranded RNA binding protein Staufen homolog
    • Double stranded RNA binding protein Staufen homolog 1
    • Double-stranded RNA-binding protein Staufen homolog 1
    • FLJ25010
    • MGC124588
    • PPP1R150
    • STAU
    • STAU1
    • STAU1_HUMAN
    • staufen
    • Staufen RNA binding protein (Drosophila)
    • Staufen RNA binding protein homolog 1
    • Staufen, Drosophila, homolog of, 1
    • Staufen, RNA binding protein, homolog 1 (Drosophila)
    • staufen-like
    see all
  • Function
    Binds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site.
  • Tissue specificity
    Widely expressed. Expressed in brain, pancreas, heart, skeletal muscles, liver, lung, kidney and placenta.
  • Sequence similarities
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Domain
    One of the DRDB could be involved in RER binding.
    The C-terminal contains the tubulin binding domain (TBD).
  • Cellular localization
    Cytoplasm. Rough endoplasmic reticulum. Localizes exclusively with the rough reticulum endoplasmic.
  • Information by UniProt

References

ab111678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up