Overview

  • Product nameHuman STCH full length protein

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP48723
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMQQYLPLPTPK VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGY ESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF SVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQ RNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLD VSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRK EEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDK LSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKIL VPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDP DLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN
    • Molecular weight54 kDa including tags
    • Amino acids23 to 471
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.
    ab104640 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General info

  • Alternative names
    • Heat shock 70 kDa protein 13
    • HEAT SHOCK 70-KD PROTEIN 13
    • heat shock protein 70kDa family, member 13
    • heat shock protein70kDa family, member13
    • HSP13_HUMAN
    • HSPA13
    • MGC133835
    • Microsomal stress 70 protein ATPase core
    • Microsomal stress-70 protein ATPase core
    • STCH
    • Stress 70 protein chaperone microsome associated 60 kDa protein
    • Stress-70 protein chaperone microsome-associated 60 kDa protein
    see all
  • FunctionHas peptide-independent ATPase activity.
  • Tissue specificityConstitutively expressed in all tissues.
  • Sequence similaritiesBelongs to the heat shock protein 70 family.
  • Cellular localizationMicrosome. Endoplasmic reticulum.
  • Information by UniProt

Human STCH full length protein images

  • 15% SDS-PAGE analysis of 3µg ab104640.

References for Human STCH full length protein (ab104640)

ab104640 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"