Human Stella full length protein (ab134623)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionQ6W0C5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMDPSQFNPTYIPGSPQMLTEENSRDDS GASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAVLREIEDE WLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKESR PFKCPCSFCVSNGWDPSENARIGNQDTKPLQP
    • Molecular weight20 kDa including tags
    • Amino acids1 to 159
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity>90% by SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General info

  • Alternative names
    • Compaction associated protein 1
    • Developmental pluripotency associated 3
    • Developmental pluripotency associated protein 3
    • Developmental pluripotency-associated protein 3
    • Dppa3
    • DPPA3_HUMAN
    • PGC7
    • Stella related protein
    • Stella-related protein
    see all
  • FunctionMay play a role in maintaining cell pluripotentiality.
  • Tissue specificityLow expression in testis, ovary and thymus. Expressed in embryonic stem and carcinoma cells. Highly expressed in testicular germ cell tumors.
  • Developmental stageExpressed in fetal ovary.
  • Cellular localizationNucleus. Cytoplasm.
  • Information by UniProt

Human Stella full length protein images

  • 15% SDS-PAGE analysis of 3 µg ab134623.

References for Human Stella full length protein (ab134623)

ab134623 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab134623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"