Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDS WLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEAD VRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQ K ILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDG LQ VTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGD YKV KYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLY KALE AAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDT FASGG ERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYP VSVPYS SAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQ SPTLTLQ STNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFA EFYRLWSV DHGEQSVVTAP
    • Amino acids4 to 504

Specifications

Our Abpromise guarantee covers the use of ab91998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • FormLyophilised
  • Additional NotesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 108 µl aqua dest.

General info

  • Alternative names
    • 2310012M03Rik
    • 3'-Tab1
    • MAP3K7IP 1
    • MAP3K7IP1
    • MGC57664
    • Mitogen activated protein kinase kinase kinase 7 interacting protein 1
    • Mitogen-activated protein kinase kinase kinase 7-interacting protein 1
    • TAB 1
    • TAB1
    • TAB1_HUMAN
    • TAK1 binding protein 1
    • TAK1-binding protein 1
    • TGF beta activated kinase 1 binding protein 1
    • TGF-beta activated kinase 1/MAP3K7 binding protein 1
    • TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
    • TGF-beta-activated kinase 1-binding protein 1
    • Transforming growth factor beta activated kinase binding protein 1
    see all
  • FunctionMay be an important signaling intermediate between TGFB receptors and MAP3K7/TAK1. May play an important role in mammalian embryogenesis.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 PP2C-like domain.
  • Post-translational
    modifications
    Monoubiquitinated. Deubiquitinated by Y.enterocolitica YopP.
  • Target information above from: UniProt accession Q15750 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Human TAB1 protein fragment images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Human TAB1 protein fragment (ab91998)

ab91998 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"