Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFA

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-Tristetraprolin antibody (ab33058)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • G0/G1 switch regulatory protein 24
    • G0S24
    • GOS24
    • Growth factor-inducible nuclear protein NUP475
    • NUP475
    • Protein TIS11A
    • RNF162A
    • TIS 11
    • TIS11
    • TIS11A
    • Tristetraprolin
    • Tristetraproline
    • TTP
    • TTP_HUMAN
    • Zfp-36
    • ZFP36
    • Zinc finger protein 36
    • Zinc finger protein 36 homolog
    • Zinc finger protein 36, C3H type, homolog (mouse)
    • Zinc finger protein, C3H type, 36 homolog
    see all
  • Function
    mRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. Acts by specifically binding ARE-containing mRNAs and promoting their degradation. Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1. Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF). Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF).
  • Sequence similarities
    Contains 2 C3H1-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylation by MAPKAPK2 increases its stability and binding to 14-3-3 proteins, leading to reduce its ARE affinity leading to inhibition of degradation of ARE-containing transcripts. Phosphorylated upon mitogen stimulation.
  • Cellular localization
    Nucleus. Cytoplasm. Localizes to stress granules upon energy starvation. phosphorylation by MAPKAPK2 promotes exclusion from stress granules.
  • Information by UniProt

References

ab111664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up