Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAN INITDISRNITSIHIENWRSLHTLN AVDMELYTGLQKLTIKNSGLRSI QPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLE QNFFNCSC DIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSH VNL TVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVH AINLTLVNVTSEDNGFTL TCIAENVVGMSNASVALTVYYPPRVVSLEE PELRLEHCIEFVVRGNPPPTLHWLHNGQPLRE SKIIHVEYYQEGEISE GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFIL FDEVSPTPPITVTHKPEEDGSSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HE ALHNHYTQKSLSLSPGK
    • Amino acids32 to 428

Specifications

Our Abpromise guarantee covers the use of ab85599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • ReconstitutionReconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • EC 2.7.10.1
    • ETS related protein neurotrophic receptor tyrosine kinase fusion
    • ETS related protein neurotrophic receptor tyrosine kinase fusion protein
    • ETV6 NTRK3 fusion
    • GP145 TrkC
    • gp145(trkC)
    • GP145-TrkC
    • GP145TrkC
    • Neurotrophic tyrosine kinase receptor type 3
    • Neurotrophin 3 receptor
    • NT 3 growth factor receptor
    • NT 3 growth factor receptor precursor
    • NT 3 receptor
    • NT-3 growth factor receptor
    • NTRK3
    • NTRK3_HUMAN
    • OTTHUMP00000192915
    • TRK C
    • Trk-C
    • TRKC
    • TrkC tyrosine kinase
    • Tyrosine kinase receptor C
    see all
  • FunctionReceptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase, and PLCG1. The different isoforms do not have identical signaling properties.
  • Tissue specificityWidely expressed but mainly in nervous tissue. Isoform B is expressed at higher levels in adult brain than in fetal brain.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ligand-mediated auto-phosphorylation.
  • Cellular localizationMembrane.
  • Information by UniProt

Human TrkC full length protein images

  • 1D SDS-PAGE of ab85599 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab85599
    Lane 2: ab85599 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab85599 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    5 mg of protein was loaded per lane. Gel was stained with Deep Purple™.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent tightening of bands after treatment with glycosidase cocktail suggests the presence of O-linked glycans.

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References for Human TrkC full length protein (ab85599)

ab85599 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"