Overview

  • Product nameHuman VTA1 full length protein
  • DescriptionHuman VTA1 full length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKID SKTPECR KFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMF LYADNEDRAGRFHKNM IKSFYTASLLIDVITVFGELTDENVKHRKYAR WKATYIHNCLKNGETPQAGPVGIEE DNDIEENEDAGAASLPTQPTQPS SSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEV PHSTGVASNTIQPT PQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQY EDVST AVQNLQKALK LLTTGRE
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab88925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % by SDS-PAGE.
    ab88925 is purifed by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General info

  • Alternative names
    • C6orf55
    • Chromosome 6 open reading frame 55
    • Dopamine responsive protein DRG 1
    • Dopamine-responsive gene 1 protein
    • DRG 1
    • DRG-1
    • DRG1
    • Homolog of mouse SKD1 binding protein 1
    • HSPC228
    • LIP5
    • LYST interacting protein 5
    • LYST-interacting protein 5
    • My012
    • SBP1
    • SKD1 binding protein 1
    • SKD1-binding protein 1
    • Vacuolar protein sorting-associated protein VTA1 homolog
    • Vps20 associated 1 homolog (S. cerevisiae)
    • VTA1
    • VTA1_HUMAN
    see all
  • FunctionInvolved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies. Involved in the sorting and down-regulation of EGFR (By similarity). Involved in HIV-1 budding.
  • Sequence similaritiesBelongs to the VTA1 family.
  • Cellular localizationCytoplasm. Endosome membrane.
  • Target information above from: UniProt accession Q9NP79 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Human VTA1 full length protein (ab88925)

ab88925 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"