Human Werner's syndrome helicase WRN protein fragment (ab112372)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14191
    • SpeciesHuman
    • SequenceNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNK RRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKL MDKTKRGGLFS
    • Molecular weight38 kDa including tags
    • Amino acids1322 to 1432

Specifications

Our Abpromise guarantee covers the use of ab112372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional Notesab112372 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General info

  • Alternative names
    • DKFZp686C2056
    • DNA helicase
    • DNA helicase, RecQ like type 3
    • Exonuclease WRN
    • HGNC 12791
    • OTTHUMP00000225301
    • RecQ protein-like 2
    • RecQ-like type 3
    • RecQ3
    • RECQL2
    • RECQL3
    • Werner syndrome ATP-dependent helicase
    • Werner syndrome helicase
    • Werner syndrome protein
    • Werner syndrome, RecQ helicase like
    • WRN
    • WRN_HUMAN
    see all
  • FunctionMultifunctional enzyme that has both magnesium and ATP-dependent DNA-helicase activity and 3'->5' exonuclease activity towards double-stranded DNA with a 5'-overhang. Has no nuclease activity towards single-stranded DNA or blunt-ended double-stranded DNA. Binds preferentially to DNA substrates containing alternate secondary structures, such as replication forks and Holliday junctions. May play an important role in the dissociation of joint DNA molecules that can arise as products of homologous recombination, at stalled replication forks or during DNA repair. Alleviates stalling of DNA polymerases at the site of DNA lesions. Important for genomic integrity. Plays a role in the formation of DNA replication focal centers; stably associates with foci elements generating binding sites for RP-A.
  • Involvement in diseaseDefects in WRN are a cause of Werner syndrome (WRN) [MIM:277700]. WRN is a rare autosomal recessive progeroid syndrome characterized by the premature onset of multiple age-related disorders, including atherosclerosis, cancer, non-insulin-dependent diabetes mellitus, ocular cataracts and osteoporosis. The major cause of death, at a median age of 47, is myocardial infarction. Currently all known WS mutations produces prematurely terminated proteins.
    Defects in WRN may be a cause of colorectal cancer (CRC) [MIM:114500].
  • Sequence similaritiesBelongs to the helicase family. RecQ subfamily.
    Contains 1 3'-5' exonuclease domain.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 HRDC domain.
  • Post-translational
    modifications
    Phosphorylated by PRKDC. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus > nucleolus. Nucleus.
  • Information by UniProt

Human Werner's syndrome helicase WRN protein fragment images

  • ab112372 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Human Werner's syndrome helicase WRN protein fragment (ab112372)

ab112372 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"