Overview

  • Product nameAnti-hunchback antibody
    See all Hunchback primary antibodies
  • Description
    Rabbit polyclonal to hunchback
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Drosophila melanogaster
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPI P) of Human hunchback (NP_731268).

  • Positive control
    • Drosophila Cell Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab105674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 83 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionGap class segmentation protein that controls development of head structures.
  • Tissue specificityIn embryo, expression of maternal transcript is highest in anterior region. Zygotic transcript is expressed in anterior region until the beginning of gastrulation and in posterior region until early gastrulation. After this, it is expressed in developing nervous system.
  • Sequence similaritiesBelongs to the hunchback C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Developmental stageExpressed maternally and zygotically. Expression of the maternal transcript decreases until embryonic stage 14, zygotic transcript is first detected at stage 11.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
    • Alternative names
      • CG9786 antibody
      • Dmel\CG9786 antibody
      • hb antibody
      • HUNB_DROME antibody
      • Protein hunchback antibody
      • R pbx antibody
      • Regulator of postbithorax antibody
      • Rg bx antibody
      • Rg pbx antibody
      see all

    Anti-hunchback antibody images

    • Anti-hunchback antibody (ab105674) at 0.25 µg/ml + Drosophila Cell Lysate at 10 µg

      Predicted band size : 83 kDa

    References for Anti-hunchback antibody (ab105674)

    ab105674 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab105674.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"