
  • Product name
  • Description
    Rabbit polyclonal to hunchback
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Drosophila melanogaster
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPI P) of Human hunchback (NP_731268).

  • Positive control
    • Drosophila Cell Lysate



Our Abpromise guarantee covers the use of ab105674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 83 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Gap class segmentation protein that controls development of head structures.
  • Tissue specificity
    In embryo, expression of maternal transcript is highest in anterior region. Zygotic transcript is expressed in anterior region until the beginning of gastrulation and in posterior region until early gastrulation. After this, it is expressed in developing nervous system.
  • Sequence similarities
    Belongs to the hunchback C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Developmental stage
    Expressed maternally and zygotically. Expression of the maternal transcript decreases until embryonic stage 14, zygotic transcript is first detected at stage 11.
  • Cellular localization
  • Information by UniProt
  • Database links
    • Alternative names
      • CG9786 antibody
      • Dmel\CG9786 antibody
      • hb antibody
      • HUNB_DROME antibody
      • Protein hunchback antibody
      • R pbx antibody
      • Regulator of postbithorax antibody
      • Rg bx antibody
      • Rg pbx antibody
      see all


    • Anti-hunchback antibody (ab105674) at 0.25 µg/ml + Drosophila Cell Lysate at 10 µg

      Predicted band size : 83 kDa


    ab105674 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab105674.
    Please use the links above to contact us or submit feedback about this product.


    Sign up