Overview

  • Product name
    Anti-HuR / ELAVL1 antibody
    See all HuR / ELAVL1 primary antibodies
  • Description
    Rabbit polyclonal to HuR / ELAVL1
  • Specificity
    The antibody detects endogenous level of total HuR / ELAVL1 protein
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human HuR/ ELAVL1 aa 1-326.
    Sequence:

    MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAK LIRDKVAGHSL GYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARP SSEVIKDANLYISGLPRTMTQKD VEDMFSRFGRIINSRVLVDQTTGLS RGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITV KFAANPNQNKNVA LLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNAS S GWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTM TNYEEAAMA IASLNGYRLGDKILQVSFKTNKSHK


    Database link: Q15717

  • Positive control
    • U251, HeLa, Jurkat, K562 and PC3 cell lysates. MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab196626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 36 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function
    Involved in 3'-UTR ARE-mediated MYC stabilization. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, HUR binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA and AUUUUUA motifs.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Methylated at Arg-217 by CARM1 in macrophages in response to LPS challenge.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ELAV (embryonic lethal abnormal vision Drosophila) like 1 antibody
    • ELAV (embryonic lethal, abnormal vision, Drosophila) like 1 (Hu antigen R) antibody
    • ELAV like 1 antibody
    • ELAV like RNA binding protein 1 antibody
    • ELAV-like protein 1 antibody
    • ELAV1 antibody
    • ELAV1_HUMAN antibody
    • Elavl1 antibody
    • Embryonic lethal abnormal vision drosophila homolog like 1 antibody
    • Hu Antigen R antibody
    • Hu-antigen R antibody
    • Hua antibody
    • HuR antibody
    • MelG antibody
    see all

Images

  • Immunofluorscence analysis of MCF7 cells labeling HuR / ELAVL1 with ab196626  at 1/100 dilution (top panel). Blue: DAPI for nuclear staining (bottom panel).

     

  • All lanes : Anti-HuR / ELAVL1 antibody (ab196626) at 1/500 dilution

    Lane 1 : U251 cell extract
    Lane 2 : HeLa cell extract
    Lane 3 : Jurkat cell extract
    Lane 4 : K562 cell extract
    Lane 5 : PC3 cell extract

    Developed using the ECL technique

    Predicted band size : 36 kDa

References

ab196626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up