Overview

  • Product name
  • Description
    Rabbit polyclonal to Hydin
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Hydin aa 1459-1552.
    Sequence:

    YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKY EMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ


    Database link: Q4G0P3

  • Positive control
    • IHC-P: Human fallopian tube tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab221643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human fallopian tube tisssue stained for Hydin with ab221643 at 1/2500 dilution in Immunohistochemical analysis.

References

ab221643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up