Overview

  • Product name
  • Description
    Rabbit polyclonal to Hydin
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Hydin aa 2111-2199.
    Sequence:

    VGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSH GSGSQKQHHSHQSETPQISSSPLPPGPIHRWLSVSPSVG


    Database link: Q4G0P3

  • Positive control
    • ICC/IF: Human SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • SiHa cells stained for Hydin (green) using ab222033 (4 µg/ml) in immunocytochemistry/ immunofluorescence.

References

ab222033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up