Overview

  • Product name
    Anti-ICT1 antibody [AT1E9]
    See all ICT1 primary antibodies
  • Description
    Mouse monoclonal [AT1E9] to ICT1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ICT1 aa 30-206. Purified from E. coli (NCBI Accession No.: NP_001536)
    Sequence:

    LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTI SYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINR LGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIR IENMNRERLRQKRIHSAVKTSRRVDMD


    Database link: Q14197

  • Positive control
    • A549 and HeLa cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 89% PBS, 10% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    AT1E9
  • Isotype
    IgG1
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 24 kDa.

Target

  • Function
    Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
  • Tissue specificity
    Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells.
  • Sequence similarities
    Belongs to the prokaryotic/mitochondrial release factor family. ICT1 subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • Digestion substraction 1 antibody
    • DS-1 antibody
    • DS1 antibody
    • Ict1 antibody
    • ICT1_HUMAN antibody
    • Immature colon carcinoma transcript 1 antibody
    • Immature colon carcinoma transcript 1 protein antibody
    • mitochondrial antibody
    • Peptidyl-tRNA hydrolase ICT1 antibody
    • Peptidyl-tRNA hydrolase ICT1, mitochondrial antibody
    see all

Images

  • All lanes : Anti-ICT1 antibody [AT1E9] (ab177528) at 1/1000 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : HeLa cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    Goat anti-mouse antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 24 kDa

References

ab177528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up