Anti-ID2 antibody [OTI10C3] (ab90055)
Key features and details
- Mouse monoclonal [OTI10C3] to ID2
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt (Intra)
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-ID2 antibody [OTI10C3]
See all ID2 primary antibodies -
Description
Mouse monoclonal [OTI10C3] to ID2 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IF, Flow Cyt (Intra)more details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Pig, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human ID2 aa 1-134. Protein expressed in E.coli. NP_002157
Sequence:MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELV PSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR TPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Database link: Q02363 -
Positive control
- IHC-P: Human liver, bladder carcinoma and liver carcinoma tissue. ICC/IF: HeLa cells. WB: pCMV6-ENTRY ID2 cDNA transfected HEK-293T cell lysate. Flow Cyt (Intra): SH-SY5Y cells.
-
General notes
The clone number has been updated from 10C3 to OTI10C3, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI10C3 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab90055 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500. Predicted molecular weight: 15 kDa.
|
|
IHC-P |
1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
|
|
ICC/IF |
1/50.
|
|
Flow Cyt (Intra) |
Use 1µg for 106 cells.
|
Notes |
---|
WB
1/500. Predicted molecular weight: 15 kDa. |
IHC-P
1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. |
ICC/IF
1/50. |
Flow Cyt (Intra)
Use 1µg for 106 cells. |
Target
-
Function
ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-2 may be an inhibitor of tissue-specific gene expression. -
Tissue specificity
Highly expressed in early fetal tissues, including those of the central nervous system. -
Sequence similarities
Contains 1 basic helix-loop-helix (bHLH) domain. -
Developmental stage
Found in most early fetal tissues but not in the corresponding mature tissues. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 505025 Cow
- Entrez Gene: 3398 Human
- Entrez Gene: 15902 Mouse
- Entrez Gene: 654298 Pig
- Entrez Gene: 25587 Rat
- Omim: 600386 Human
- SwissProt: Q3ZC46 Cow
- SwissProt: Q4R5J7 Cynomolgus monkey
see all -
Alternative names
- bHLHb26 antibody
- Cell growth inhibiting gene 8 antibody
- class B basic helix loop helix protein 26 antibody
see all
Images
-
All lanes : Anti-ID2 antibody [OTI10C3] (ab90055) at 1/500 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells were transfected with the pCMV6-ENTRY control
Lane 2 : HEK-293T cells were transfected with the pCMV6-ENTRY ID2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 15 kDa -
Paraffin-embedded human bladder carcinoma tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for ID2 using ab90055 at a 1/50 dilution in ICC/IF.
-
Paraffin-embedded human liver tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Paraffin-embedded human liver carcinoma tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Overlay histogram showing SH-SY5Y cells stained with ab90055 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab90055, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab90055 has been referenced in 2 publications.
- Dong P et al. Roles of ERRα and TGF-β signaling in stemness enhancement induced by 1 µM bisphenol A exposure via human neural stem cells. Exp Ther Med 23:164 (2022). PubMed: 35069845
- Amaral LHP et al. ID Proteins May Reduce Aggressiveness of Thyroid Tumors. Endocr Pathol N/A:N/A (2018). PubMed: 30413933