Overview

  • Product nameAnti-IER5 antibody
    See all IER5 primary antibodies
  • Description
    Rabbit polyclonal to IER5
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLS D) of Human IER5 (NP_057629).

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab97939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Optimal concentration of antibody depends the protein level in a given sample. Our recommended concentrations are the starting point for general use. Customers are advised have to do a series of titration tests to determine optimal concentration. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-IER5 antibody images

  • Anti-IER5 antibody (ab97939) at 1 µg/ml + HepG2 cell lysate at 10 µg with 5% skim milk in PBS buffer

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 34 kDa

References for Anti-IER5 antibody (ab97939)

This product has been referenced in:
  • Robinson PM  et al. Proteolytic processing of connective tissue growth factor in normal ocular tissues and during corneal wound healing. Invest Ophthalmol Vis Sci 53:8093-103 (2012). Read more (PubMed: 23139278) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab97939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"