
  • Product name
  • Description
    Rabbit polyclonal to IFFO
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 151-200 (VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSM R) of Human IFFO (NM_080731).

  • Positive control
    • HeLa cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab108177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-IFFO antibody images

  • Anti-IFFO antibody (ab108177) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size : 23 kDa

References for Anti-IFFO antibody (ab108177)

ab108177 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108177.
Please use the links above to contact us or submit feedback about this product.


Sign up