• Product nameAnti-IFN gamma Receptor beta antibody
    See all IFN gamma Receptor beta primary antibodies
  • Description
    Rabbit polyclonal to IFN gamma Receptor beta
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 179-228 (WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGH L) of human IFN gamma Receptor beta (NP_005525).

  • Positive control
    • Human Fetal Liver Lysate



Our Abpromise guarantee covers the use of ab84524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionPart of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GAF, JAK1, and/or JAK2.
  • Involvement in diseaseDefects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity, whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
  • Sequence similaritiesBelongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AF 1 antibody
    • AF-1 antibody
    • AF1 antibody
    • IFGR 2 antibody
    • IFGR2 antibody
    • IFN-gamma receptor 2 antibody
    • IFN-gamma-R2 antibody
    • IFNGR 2 antibody
    • IFNGR2 antibody
    • IFNGT 1 antibody
    • IFNGT1 antibody
    • IMD28 antibody
    • INGR2_HUMAN antibody
    • Interferon gamma receptor 2 (interferon gamma transducer 1) antibody
    • Interferon gamma receptor 2 antibody
    • Interferon gamma receptor accessory factor 1 antibody
    • Interferon gamma receptor beta chain antibody
    • Interferon gamma receptor chain 2 antibody
    • Interferon gamma transducer 1 antibody
    see all

Anti-IFN gamma Receptor beta antibody images

  • Anti-IFN gamma Receptor beta antibody (ab84524) at 1 µg/ml + Human Fetal Liver lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 38 kDa
    Observed band size : 38 kDa
    Additional bands at : 28 kDa. We are unsure as to the identity of these extra bands.

References for Anti-IFN gamma Receptor beta antibody (ab84524)

This product has been referenced in:
  • Assani K  et al. IFN-? stimulates autophagy-mediated clearance of Burkholderia cenocepacia in human cystic fibrosis macrophages. PLoS One 9:e96681 (2014). WB . Read more (PubMed: 24798083) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab84524.
Please use the links above to contact us or submit feedback about this product.