Overview

  • Product name
  • Description
    Mouse polyclonal to IFNAR1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human IFNAR1 aa 1-557. (NP_000620).
    Sequence:

    MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWN RSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEI KLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVIHISPGT KDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCL KVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDY TYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYI GAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLT VYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFAL PFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIE KCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSE ELQQDFV


    Database link: P17181

  • Positive control
    • IFNAR1 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa.

Target

  • Function
    Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves.
  • Tissue specificity
    IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266S. Isoform 2 and isoform 3 are expressed in the IFN-alpha resistant myeloma cell line U266R. Isoform 1 is not expressed in IFN-alpha resistant myeloma cell line U266R.
  • Sequence similarities
    Belongs to the type II cytokine receptor family.
    Contains 3 fibronectin type-III domains.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by TYK2 tyrosine kinase.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha type antiviral protein antibody
    • Antiviral protein, alpha-type antibody
    • Antiviral protein, beta-type antibody
    • AVP antibody
    • Beta type antiviral protein antibody
    • CRF2-1 antibody
    • Cytokine receptor class-II member 1 antibody
    • Cytokine receptor family 2 member 1 antibody
    • IFN alpha REC antibody
    • IFN alpha receptor antibody
    • IFN alpha/beta Receptor alpha antibody
    • IFN beta receptor antibody
    • IFN Interferon-beta receptor antibody
    • IFN-alpha/beta receptor 1 antibody
    • IFN-R-1 antibody
    • IFNAR antibody
    • Ifnar1 antibody
    • IFNBR antibody
    • IFRC antibody
    • INAR1_HUMAN antibody
    • Interferon (alpha beta and omega) receptor 1 antibody
    • interferon alpha and beta receptor subunit 1 antibody
    • Interferon alpha/beta receptor 1 antibody
    • Interferon alpha/beta receptor alpha chain antibody
    • Interferon beta receptor 1 antibody
    • interferon receptor 1 antibody
    • Interferon-alpha receptor antibody
    • Type I interferon receptor 1 antibody
    see all

Images

  • All lanes : Anti-IFNAR1 antibody (ab171996) at 1 µg/ml

    Lane 1 : IFNAR1 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP conjugated at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 64 kDa

References

ab171996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up