Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP48551
    • SpeciesHuman
    • SequenceTheoretical Sequence ISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKP EDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNF WLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEG IVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLK CTLLPPGQESESAESAKGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK
    • Additional sequence informationA fusion of the signal peptide and extracellular domain of human IFNAR2 (aa 1-243) and the Fc region of human IgG1 (aa90-330). The chimeric protein was expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab83680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab83680 bound to protein A sepharose beads was able to pull down its ligand, IFNa2b.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Additional Notesab83680 bound to protein A sepharose beads was able to pull down its ligand, IFNa2b.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • Human interferon alpha/beta receptor
    • IFN alpha REC
    • IFN R
    • IFN-a/ßR2
    • IFN-a/ßRß
    • IFN-alpha binding protein
    • IFN-alpha/beta receptor 2
    • IFN-R-2
    • IFNABR
    • IFNAR2
    • IFNARB
    • IFNR
    • INAR2_HUMAN
    • Interferon (alpha beta and omega) receptor 2
    • Interferon alpha binding protein
    • Interferon alpha/beta receptor 2
    • Interferon alpha/beta receptor beta chain
    • Type I interferon receptor
    • Type I interferon receptor 2
    see all
  • FunctionAssociates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
  • Tissue specificityIsoform 3 is detected in the urine (at protein level). Expressed in blood cells. Expressed in lymphoblastoid and fibrosarcoma cell lines.
  • Sequence similaritiesBelongs to the type II cytokine receptor family.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues upon interferon binding. Phosphorylation at Tyr-337 or Tyr-512 are sufficient to mediate interferon dependent activation of STAT1, STAT2 and STAT3 leading to antiproliferative effects on many different cell types.
    Glycosylated.
  • Cellular localizationSecreted and Membrane.
  • Information by UniProt

IFNAR2 protein (Fc Chimera) images

  • Densitometry of protein isoforms visualised by 2-DE. The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83680 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1 MW markers; Lane 2 ab83680; Lane 3 ab83680 treated with PNGase F to remove potential N-linked glycans; Lane 4 ab83680 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 μg of protein was loaded per lane.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.

  • A sample of ab83680 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 μg of protein was load; Gel was stained using Deep Purple™.

References for IFNAR2 protein (Fc Chimera) (ab83680)

ab83680 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"