Overview

  • Product name
  • Description
    Rabbit polyclonal to Ifnb1
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ifnb1 aa 30-187.
    Sequence:

    LQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALT IYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEK EDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFIN RLTGYLRN


    Database link: P01574

  • Positive control
    • HepG2  cell line extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab180616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Relevance
    The mammalian type I Inteferons (IFN1) are produced in response to viral infection and other inducers. They are divided into alpha and beta subtypes leukocytes and fibroblasts reactivity. The human IFN alphas are encoded by a family of at least 15 different genes, while IFN beta is the unique member of its subtype. There is approximately 50% amino acid homology between the alpha and beta subtypes. Both IFN subtypes are pleiotropic cytokines and have a similar range of biological activities. Differences between alpha subtypes, and between IFN alpha and betas, are in potency and cell type specific activities. In particular, IFN beta elicits a markedly higher antiproliferation response in some cell types such as, embryonal carcinoma, melanoma and melanocytes than do IFN alphas. Higher potency of IFN beta in treatment of multiple sclerosis and certain cancers has been observed. Type I IFNs signal through binding to a common cell surface receptor. Two chains of the receptor, IFNAR1 and IFNAR2, have been identified. Both chains are necessary for function and in the absence of either there is neither high affinity binding nor biological activity. The intracellular portions of the receptor subunits are bound by tyrosine kinases, Jak1 and Tyk2, members of the Janus kinase family. Upon ligand binding these kinases are activated and phosphorylate members of the STAT family of transcription factors, as well as IFNAR1 and 2.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • Beta-interferon antibody
    • Fibroblast interferon antibody
    • Ifb antibody
    • IFF antibody
    • IFN beta antibody
    • IFN, fibroblast antibody
    • IFNB antibody
    • Ifnb1 antibody
    • interferon beta 1, fibroblast antibody
    • Interferon beta antibody
    • MGC96956 antibody
    • OTTHUMP00000021131 antibody
    • RP23-19G2.2 antibody
    see all

Images

  • Anti-Ifnb1 antibody (ab180616) at 1/500 dilution + HepG2 cell line extract

    Predicted band size : 22 kDa

References

ab180616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up