Overview

  • Product name
  • Description
    Rabbit polyclonal to IFRD2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IFRD2 aa 1-442.
    Sequence:

    MPRARKGNTLRKGGQRRGGGARSSAQADSGSSDDEAASEARSTASECPSL LSTTAEDSLGGDVVDEQGQQEDLEEKLKEYVDCLTDKSAKTRQGALESLR LALASRLLPDFLLERRLTLADALEKCLKKGKGEEQALAAAVLGLLCVQLG PGPKGEELFHSLQPLLVSVLSDSTASPAARLHCASALGLGCYVAAADIQD LVSCLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICP STQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFELARDLEEEFVY EDMEALCSVLRTLATDSNKYRAKADRRRQRSTFRAVLHSVEGGECEEEIV RFGFEVLYMDSWARHRIYAAFKEVLGSGMHHHLQNNELLRDIFGLGPVLL LDATALKACKVPRFEKHLYNAAAFKARTKARSRVRDKRADIL


    Database link: NM_006764.3

  • Positive control
    • IFRD2 transfected 293T cell line lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa.

Target

  • Tissue specificity
    Expressed in a variety of tissues.
  • Sequence similarities
    Belongs to the IFRD family.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ40446 antibody
    • IFNRP antibody
    • IFRD 2 antibody
    • IFRD2 antibody
    • IFRD2_HUMAN antibody
    • Interferon related developmental regulator 2 antibody
    • Interferon related protein antibody
    • Interferon-related developmental regulator 2 antibody
    • Protein SKMC15 antibody
    • SKMc 15 antibody
    • SKMc15 antibody
    • SKMC15 protein antibody
    • SM 15 antibody
    • SM15 antibody
    see all

Images

  • All lanes : Anti-IFRD2 antibody (ab172218) at 1 µg/ml

    Lane 1 : IFRD2 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    Goat Anti-Rabbit IgG at 1/7500 dilution

    Predicted band size : 48 kDa

References

ab172218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up