Overview

  • Product name
    Anti-IGJ antibody [KT109]
    See all IGJ primary antibodies
  • Description
    Mouse monoclonal [KT109] to IGJ
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IGJ aa 1-159.
    Sequence:

    MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSED PNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVE LDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETA LTPDACYPD


    Database link: P01591

  • Positive control
    • Purified serum IgA; Human saliva

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituent: 99.9% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    KT109
  • Isotype
    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.
ELISA Use a concentration of 1 µg/ml.

Target

  • Function
    Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • IGCJ antibody
    • IGJ_HUMAN antibody
    • Immunoglobulin J chain antibody
    • Immunoglobulin J polypeptide linker protein for immunoglobulin alpha and mu polypeptides antibody
    • immunoglobulin joining chain antibody
    • JCH antibody
    • JCHAIN antibody
    • Joining chain of multimeric IgA and IgM antibody
    see all

Images

  • Anti-IGJ antibody [KT109] (ab169854) at 1 µg/ml + Purified serum IgA.

    Predicted band size : 18 kDa
  • Anti-IGJ antibody [KT109] (ab169854) at 1 µg/ml + Human saliva

    Predicted band size : 18 kDa

References

ab169854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up