Overview

Properties

Applications

Our Abpromise guarantee covers the use of ab9614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration. To detect hIL-1a by direct ELISA (using 100µl/well antibody solution) a concentration of at least 0.5µg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with compatible secondary reagents, allows the detection of 0.2 - 0.4 ng/well of recombinant hIL-1a.
Neutralising Use at an assay dependent concentration. To yield one-half maximal inhibition [ND50] of the biological activity of hIL-1a (20 ng/ml), a concentration of 1.0 - 2.0 µg/ml of this antibody is required.
WB Use at an assay dependent concentration. To detect hIL-1a by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant hIL-1a is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
IHC-P Use a concentration of 1 µg/ml. Perform enzymatic antigen retrieval before commencing with IHC staining protocol. Incubate overnight, at 4oC.

Target

  • FunctionProduced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similaritiesBelongs to the IL-1 family.
  • DomainThe similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localizationSecreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt
  • Database links
  • Alternative names
    • BAF antibody
    • FAF antibody
    • Hematopoietin 1 antibody
    • Hematopoietin-1 antibody
    • IL 1 alpha antibody
    • IL 1A antibody
    • IL-1 alpha antibody
    • Il-1a antibody
    • IL1 ALPHA antibody
    • IL1 antibody
    • IL1A antibody
    • IL1A_HUMAN antibody
    • IL1F1 antibody
    • Interleukin 1 alpha antibody
    • Interleukin-1 alpha antibody
    • Interleukin1 alpha antibody
    • LAF antibody
    • LEM antibody
    • Preinterleukin 1 alpha antibody
    • Pro interleukin 1 alpha antibody
    see all

Anti-IL1 alpha antibody images

  • ab9614 at 1.0 µg/ml staining normal human skin by IHC-P. The antibody was incubated overnight at 4°C. An HRP-labeled polymer detection system was used with a non-alcohol soluble AEC chromogen. Enzyme induced antigen retrieval was performed with proteinase K.
  • ab9614 at 1/50 staining IL1 in human primary tonsillar epithelial cell by immunocytochemistry/ immunofluorescence. The cells were paraformaldehyde fixed and blocked with 20% serum prior to incubation with the antibody for 1 hour. Alexa fluor® 594 goat polyclonal to rabbit Ig, diluted 1/1000, was used as the secondary antibody.

    See Abreview

  • Anti-IL1 alpha antibody (ab9614) at 1 µg/ml + Recombinant human IL1 alpha protein (ab73567) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 30 seconds

References for Anti-IL1 alpha antibody (ab9614)

This product has been referenced in:
  • Andersen K  et al. The NLRP3/ASC inflammasome promotes T-cell-dependent immune complex glomerulonephritis by canonical and noncanonical mechanisms. Kidney Int N/A:N/A (2014). Mouse . Read more (PubMed: 24805106) »
  • Botelho FM  et al. IL-1a/IL-1R1 Expression in Chronic Obstructive Pulmonary Disease and Mechanistic Relevance to Smoke-Induced Neutrophilia in Mice. PLoS One 6:e28457 (2011). IHC-P ; Human . Read more (PubMed: 22163019) »

See all 2 Publications for this product

Product Wall

Thank you for contacting us.

As shown on the product datasheets, ab9614 and ab18256 are bothpolyclonal antibodies. The same negative control should therefore besuitable for both products.

I hope this information is helpful to you. Ple...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Human Cell lysate - whole cell (SCC12F - human oro-facial keratinocyte)
Loading amount 30 µg
Specification SCC12F - human oro-facial keratinocyte
Gel Running Conditions Reduced Denaturing (15%)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Username

Dr. Mhairi Morris

Verified customer

Submitted Jan 28 2010

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Human Cell (Human primary tonsillar epithelial cell)
Specification Human primary tonsillar epithelial cell
Fixative Paraformaldehyde
Permeabilization Yes - 0.5% Triton X-100
Blocking step Serum as blocking agent for 15 minute(s) · Concentration: 20% · Temperature: 23°C
Username

Dr. Mhairi Morris

Verified customer

Submitted Sep 09 2009

The human IL-1 peptide sequence used to raise this antibody is: SAPFSFLSNVKYNFMRIIKYEFILNDALNQ SIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA (159 amino acid residues, ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"