Overview

  • Product nameAnti-IL15 antibody
    See all IL15 primary antibodies
  • Description
    Mouse monoclonal to IL15
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL15 aa 49-162.
    Sequence:

    NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVI SLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINTS


    Database link: P40933

Properties

Applications

Our Abpromise guarantee covers the use of ab55282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 3 µg/ml.

Target

  • FunctionCytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
  • Tissue specificityMost abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
  • Sequence similaritiesBelongs to the IL-15/IL-21 family.
  • Cellular localizationSecreted and Cytoplasm. Nucleus. IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.
  • Information by UniProt
  • Database links
  • Alternative names
    • IL 15 antibody
    • IL-15 antibody
    • IL15 antibody
    • IL15_HUMAN antibody
    • Interleukin 15 antibody
    • Interleukin-15 antibody
    • Interleukin15 antibody
    • MGC9721 antibody
    see all

Anti-IL15 antibody images

  • IL15 antibody (ab55282) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human placenta.

References for Anti-IL15 antibody (ab55282)

This product has been referenced in:
  • O'Mahony FC  et al. The use of automated quantitative analysis to evaluate epithelial-to-mesenchymal transition associated proteins in clear cell renal cell carcinoma. PLoS One 7:e31557 (2012). IHC-P ; Human . Read more (PubMed: 22363672) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab55282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"