Overview

  • Product name
  • Description
    Rabbit polyclonal to IL2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Rat IL2 aa 21-155. E. coli-derived.
    Sequence:

    APTSSPAKETQQHLEQLLLDLQVLLRGIDNYKNLKLPMMLTFKFYLPKQA TELKHLQCLE NELGALQRVLDLTQSKSFHLEDAGNFISNIRVTVVKLK GSENKFECQFDDEPATVVEFLR RWIAICQSIISTMTQ


    Database link: P17108

  • Positive control
    • Rat thymus, liver lysates, NRK, PC12, RH35 cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.025% Sodium azide
    Constituents: 0.45% Sodium chloride, 0.1% Dibasic monohydrogen sodium phosphate, 2.5% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 18 kDa.

Target

  • Function
    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease
    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities
    Belongs to the IL-2 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Aldesleukin antibody
    • IL 2 antibody
    • IL-2 antibody
    • IL2 antibody
    • IL2_HUMAN antibody
    • Interleukin 2 antibody
    • Interleukin-2 antibody
    • Involved in regulation of T cell clonal expansion antibody
    • Lymphokine antibody
    • OTTHUMP00000164090 antibody
    • POIL2 antibody
    • T Cell Growth Factor antibody
    • T-cell growth factor antibody
    • TCGF antibody
    see all

Images

  • All lanes : Anti-IL2 antibody (ab191150) at 0.5 µg/ml

    Lane 1 : Rat thymus lysate
    Lane 2 : Rat liver lysate
    Lane 3 : NRK whole cell lysate
    Lane 4 : PC12 whole cell lysate
    Lane 5 : RH35 whole cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 18 kDa

References

ab191150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up