Anti-IL2 Receptor gamma antibody [15C5] (ab194613)

Overview

  • Product name
    Anti-IL2 Receptor gamma antibody [15C5]
    See all IL2 Receptor gamma primary antibodies
  • Description
    Rat monoclonal [15C5] to IL2 Receptor gamma
  • Tested applications
    Suitable for: WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse IL2 Receptor gamma.
    Sequence:

    WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNC TWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDI QLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLEL RWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTF RVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALE


    Database link: P34902

Properties

Applications

Our Abpromise guarantee covers the use of ab194613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 42 kDa.
Flow Cyt Use at an assay dependent concentration.

Target

  • Function
    Common subunit for the receptors for a variety of interleukins.
  • Involvement in disease
    Defects in IL2RG are the cause of severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID) [MIM:300400]; also known as agammaglobulinemia Swiss type. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
    Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) [MIM:312863]. XCID is a less severe form of X-linked immunodeficiency with a less severe degree of deficiency in cellular and humoral immunity than that seen in XSCID.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD132 antibody
    • CD132 antigen antibody
    • CIDX antibody
    • common cytokine receptor gamma chain antibody
    • Cytokine receptor common subunit gamma antibody
    • Gamma C antibody
    • gamma(c) antibody
    • gammaC antibody
    • IL-2 receptor subunit gamma antibody
    • IL-2R gamma chain antibody
    • IL-2R subunit gamma antibody
    • IL-2RG antibody
    • Il2rg antibody
    • IL2RG_HUMAN antibody
    • IMD4 antibody
    • interleukin 2 receptor, gamma antibody
    • Interleukin-2 receptor subunit gamma antibody
    • p64 antibody
    • SCIDX antibody
    • SCIDX1 antibody
    see all

References

ab194613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up