Overview

  • Product name
  • Description
    Goat polyclonal to IL21
  • Specificity
    Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
  • Tested applications
    Suitable for: ELISA, ICCmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide:

    CRHLIDIVEQLKIYENDLDPELLSAPQDVK

    , corresponding to N terminal amino acids 32-61 of Mouse IL21.

  • Positive control
    • Spleen.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.1% Sodium Azide
    Constituents: 140mM Sodium chloride, 10mM Potassium phosphate. pH 7.2
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab18496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/100000.
ICC 1/500.

Target

  • Function
    Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
  • Tissue specificity
    Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
  • Sequence similarities
    Belongs to the IL-15/IL-21 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • CVID11 antibody
    • IL 21 antibody
    • IL-21 antibody
    • Il21 antibody
    • IL21_HUMAN antibody
    • Interleukin 21 antibody
    • Interleukin-21 antibody
    • interleukin-21 isoform antibody
    • Interleukin21 antibody
    • OTTHUMP00000164088 antibody
    • Za11 antibody
    see all

Images

  • ab18496 used for the immunohistochemical detection of mouse N-terminal IL21 in spleen.

References

ab18496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab18496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up