Overview

  • Product nameAnti-IL21 Receptor antibody
    See all IL21 Receptor primary antibodies
  • Description
    Rabbit polyclonal to IL21 Receptor
  • Tested applicationsSuitable for: ELISA, Flow Cyt, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide:

    CVLETRSPNPSILSLTWQDEYEELQDQETF

    , corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.

  • Positive control
    • Mouse thymus/spleen.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: 0.1% Sodium Azide
    Constituents: PBS, pH 7.2
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab13268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/100000.
Flow Cyt Use at an assay dependent concentration. ab171870-Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.
IHC-P 1/300.

Target

  • FunctionThis is a receptor for interleukin-21.
  • Tissue specificitySelectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD360 antibody
    • IL 21R antibody
    • IL-21 receptor antibody
    • IL-21R antibody
    • IL21 receptor antibody
    • IL21R antibody
    • IL21R_HUMAN antibody
    • Interleukin 21 receptor antibody
    • Interleukin-21 receptor antibody
    • MGC10967 antibody
    • NILR antibody
    • Novel interleukin receptor antibody
    see all

Anti-IL21 Receptor antibody images

  • Immunohistochemistry on mouse thymus with rabbit antibody to N-terminus of mouse IL-21 receptor.

References for Anti-IL21 Receptor antibody (ab13268)

This product has been referenced in:
  • Tzartos JS  et al. IL-21 and IL-21 receptor expression in lymphocytes and neurons in multiple sclerosis brain. Am J Pathol 178:794-802 (2011). IHC-P ; Human . Read more (PubMed: 21281812) »
  • Barker BR  et al. IL-21 induces apoptosis of antigen-specific CD8+ T lymphocytes. J Immunol 179:3596-603 (2007). Flow Cyt ; Rhesus monkey . Read more (PubMed: 17785794) »

See all 3 Publications for this product

Product Wall

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has ca...

Read More

Thank you very much for sending the images. The images show this antibody is not staining at all. Also you have already tried different antigen retrieval procedures so perhaps the vial you have received is a bad vial. I am happy to replace the anti...

Read More

Thank you for your enquiry regarding ab13268 and for taking the time to provide some useful details of the experiments. I am very sorry to hear that you are having problems with this antibody. The protocol looks fine however I would be interested i...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application Flow Cytometry
Sample Mouse Cell (primary mouse splenocytes)
Specification primary mouse splenocytes
Fixation Paraformaldehyde
Permeabilization No
Gating Strategy lymphocytes based on FSC/SSC
Username

Nadine Pouw

Verified customer

Submitted May 20 2010

Thank you for your patience. The originator of ab12953 and ab13396 has gotten back to me with the standard IHC protocol that they follow which I have included below. If you have any additional questions, please let me know. Tissue Preparation: ...

Read More

Thank you for your phone call. For ab13268, ab1662, and ab1669, the originator has informed me that the antigen retrieval method for IHC-formalin fixed, paraffin embedded sections involved treating the sections with antigen retrieval solution (Dako # S...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"