Overview

  • Product name
    Anti-IL21 Receptor antibody
    See all IL21 Receptor primary antibodies
  • Description
    Goat polyclonal to IL21 Receptor
  • Tested applications
    Suitable for: IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide:

    CILEMWNLHPSTLTLTWQDQYEELKDEATS

    , corresponding to N-term amino acids 35-65 of Human IL21 Receptor.

  • Positive control
    • Human lung/tonsil.
  • General notes
    Stable for at least 3 years when stored at -80°C

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.1% Sodium Azide
    Constituents: PBS, pH 7.2
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab13321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/300.
ELISA 1/100000.

Target

  • Function
    This is a receptor for interleukin-21.
  • Tissue specificity
    Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD360 antibody
    • IL 21R antibody
    • IL-21 receptor antibody
    • IL-21R antibody
    • IL21 receptor antibody
    • IL21R antibody
    • IL21R_HUMAN antibody
    • Interleukin 21 receptor antibody
    • Interleukin-21 receptor antibody
    • MGC10967 antibody
    • NILR antibody
    • Novel interleukin receptor antibody
    see all

Images

  • ab13321 used in IHC staining human lung at 1/300 dilution.

References

ab13321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab13321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up