Overview

  • Product nameAnti-IL21 Receptor antibody
    See all IL21 Receptor primary antibodies
  • Description
    Goat polyclonal to IL21 Receptor
  • Tested applicationsSuitable for: IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide:

    CILEMWNLHPSTLTLTWQDQYEELKDEATS

    , corresponding to N-term amino acids 35-65 of Human IL21 Receptor.

  • Positive control
    • Human lung/tonsil.
  • General notesStable for at least 3 years when stored at -80°C

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: 0.1% Sodium Azide
    Constituents: PBS, pH 7.2
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab13321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/300.
ELISA 1/100000.

Target

  • FunctionThis is a receptor for interleukin-21.
  • Tissue specificitySelectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD360 antibody
    • IL 21R antibody
    • IL-21 receptor antibody
    • IL-21R antibody
    • IL21 receptor antibody
    • IL21R antibody
    • IL21R_HUMAN antibody
    • Interleukin 21 receptor antibody
    • Interleukin-21 receptor antibody
    • MGC10967 antibody
    • NILR antibody
    • Novel interleukin receptor antibody
    see all

Anti-IL21 Receptor antibody images

  • ab13321 used in IHC staining human lung at 1/300 dilution.

References for Anti-IL21 Receptor antibody (ab13321)

ab13321 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab13321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"