Overview

  • Product name
    Anti-IL21 Receptor antibody
    See all IL21 Receptor primary antibodies
  • Description
    Goat polyclonal to IL21 Receptor
  • Tested applications
    Suitable for: IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide:

    CILEMWNLHPSTLTLTWQDQYEELKDEATS

    , corresponding to N-term amino acids 35-65 of Human IL21 Receptor.

  • Positive control
    • Human lung/tonsil.
  • General notes
    Stable for at least 3 years when stored at -80°C

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.1% Sodium Azide
    Constituents: PBS, pH 7.2
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab13321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/300.
ELISA 1/100000.

Target

  • Function
    This is a receptor for interleukin-21.
  • Tissue specificity
    Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD360 antibody
    • IL 21R antibody
    • IL-21 receptor antibody
    • IL-21R antibody
    • IL21 receptor antibody
    • IL21R antibody
    • IL21R_HUMAN antibody
    • Interleukin 21 receptor antibody
    • Interleukin-21 receptor antibody
    • MGC10967 antibody
    • NILR antibody
    • Novel interleukin receptor antibody
    see all

Anti-IL21 Receptor antibody images

  • ab13321 used in IHC staining human lung at 1/300 dilution.

References for Anti-IL21 Receptor antibody (ab13321)

ab13321 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab13321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up