Anti-IL22 Receptor Alpha antibody (ab98917)

Overview

  • Product nameAnti-IL22 Receptor Alpha antibody
    See all IL22 Receptor Alpha primary antibodies
  • Description
    Rabbit polyclonal to IL22 Receptor Alpha
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 251-300 (

    YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

    ) of Human IL22 Receptor Alpha (NP_067081).

  • Positive control
    • Human fetal kidney cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-IL22 Receptor Alpha antibody images

  • Anti-IL22 Receptor Alpha antibody (ab98917) at 1 µg/ml + Human fetal kidney cell lysate at 10 µg

    Predicted band size : 63 kDa

References for Anti-IL22 Receptor Alpha antibody (ab98917)

ab98917 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"