Overview

  • Product name
  • Description
    Rabbit polyclonal to IL28B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL28B aa 22-196. Mature sequence.
    Sequence:

    VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKC RSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQ PLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLE ASVTFNLFRLLTRDLNCVASGDLCV


    Database link: Q8IZI9

  • Positive control
    • 293T cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function
    Cytokine with immunomodulatory activity. Up-regulates MHC class I antigen expression. Displays potent antiviral activity. Also displays antitumor activity. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
  • Sequence similarities
    Belongs to the IL-28/IL-29 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cytokine ZCYTO22 antibody
    • IFN-lambda-3 antibody
    • IFN-lambda-4 antibody
    • IL-28B antibody
    • IL-28C antibody
    • IL28B antibody
    • IL28B_HUMAN antibody
    • IL28C antibody
    • Interferon lambda-3 antibody
    • Interferon lambda-4 antibody
    • interleukin 28B (interferon, lambda 3) antibody
    • Interleukin 28C antibody
    • Interleukin-28B antibody
    • Interleukin-28C antibody
    see all

Images

  • Anti-IL28B antibody (ab189858) at 1/500 dilution + 293T cell extract

    Predicted band size: 22 kDa

References

ab189858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up