Overview

  • Product name
  • Description
    Mouse polyclonal to IL32
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human IL32 aa 1-188. (NP_001012649).
    Sequence:

    MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDF KEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEP GESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQS FCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK


    Database link: P24001-2

  • Positive control
    • IL32 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Function
    Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
  • Tissue specificity
    Selectively expressed in lymphocytes. Expression more prominent in immunce cells than in non-immune cells.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • IL 32alpha antibody
    • IL 32beta antibody
    • IL 32delta antibody
    • IL 32gamma antibody
    • IL-32 antibody
    • IL32 antibody
    • IL32_HUMAN antibody
    • Interleukin 32 antibody
    • Interleukin 32 small antibody
    • Interleukin 32 theta antibody
    • Interleukin-32 antibody
    • interleukin-32 eta antibody
    • Natural killer cell transcript 4 antibody
    • Natural killer cells protein 4 antibody
    • NK 4 antibody
    • NK4 antibody
    • OTTHUMP00000236040 antibody
    • OTTHUMP00000236041 antibody
    • OTTHUMP00000236042 antibody
    • OTTHUMP00000236043 antibody
    • OTTHUMP00000236044 antibody
    • OTTHUMP00000236045 antibody
    • OTTHUMP00000236046 antibody
    • OTTHUMP00000236047 antibody
    • OTTHUMP00000236048 antibody
    • OTTHUMP00000236049 antibody
    • OTTHUMP00000236050 antibody
    • OTTHUMP00000236051 antibody
    • OTTHUMP00000236052 antibody
    • OTTHUMP00000236053 antibody
    • OTTHUMP00000236054 antibody
    • OTTHUMP00000241545 antibody
    • OTTHUMP00000241602 antibody
    • OTTHUMP00000241603 antibody
    • OTTHUMP00000241604 antibody
    • OTTHUMP00000241605 antibody
    • OTTHUMP00000241606 antibody
    • OTTHUMP00000241607 antibody
    • OTTHUMP00000241608 antibody
    • OTTHUMP00000241609 antibody
    • OTTHUMP00000241610 antibody
    • OTTHUMP00000241611 antibody
    • OTTHUMP00000241612 antibody
    • TAIF antibody
    • TAIFa antibody
    • TAIFb antibody
    • TAIFc antibody
    • TAIFd antibody
    • Tumor necrosis factor alpha-inducing factor antibody
    see all

Images

  • All lanes : Anti-IL32 antibody (ab172339) at 1 µg/ml

    Lane 1 : IL32 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique

    Predicted band size : 22 kDa

References

ab172339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up