Overview

  • Product name
  • Description
    Rabbit polyclonal to IMP3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human IMP3 aa 1-50. The exact sequence is proprietary.
    Sequence:

    MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWA


    Database link: O00425

  • Positive control
    • HeLa, Jurkat and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 64 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    RNA-binding protein that act as a regulator of mRNA translation and stability. Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binds to sequences in the 3'-UTR of CD44 mRNA.
  • Tissue specificity
    Expressed in fetal liver, fetal lung, fetal kidney, fetal thymus, fetal placenta, fetal follicles of ovary and gonocytes of testis, growing oocytes, spermatogonia and semen (at protein level). Expressed in cervix adenocarcinoma, in testicular, pancreatic and renal-cell carcinomas (at protein level). Expressed ubiquitously during fetal development at 8 and 14 weeks of gestation. Expressed in ovary, testis, brain, placenta, pancreatic cancer tissues and pancreatic cancer cell lines.
  • Sequence similarities
    Belongs to the RRM IMP/VICKZ family.
    Contains 4 KH domains.
    Contains 2 RRM (RNA recognition motif) domains.
  • Domain
    The third and fourth KH domains are important for binding to the untranslated region (UTR) of target mRNA.
  • Cellular localization
    Nucleus. Cytoplasm. Found in lamellipodia of the leading edge, in the perinuclear region, and beneath the plasma membrane. The subcytoplasmic localization is cell specific and regulated by cell contact and growth. Localized at the connecting piece and the tail of the spermatozoa. Colocalized with CD44 mRNA in RNP granules.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 98 antibody
    • CT98 antibody
    • DKFZp686F1078 antibody
    • hKOC antibody
    • IF2B3_HUMAN antibody
    • IGF II mRNA binding protein 3 antibody
    • IGF-II mRNA-binding protein 3 antibody
    • IGF2 mRNA binding protein 3 antibody
    • IGF2 mRNA-binding protein 3 antibody
    • IGF2BP3 antibody
    • IMP 3 antibody
    • IMP-3 antibody
    • Insulin like growth factor 2 mRNA binding protein 3 antibody
    • Insulin-like growth factor 2 mRNA-binding protein 3 antibody
    • KH domain containing protein overexpressed in cancer antibody
    • KH domain-containing protein overexpressed in cancer antibody
    • KOC 1 antibody
    • KOC1 antibody
    • VICKZ 3 antibody
    • VICKZ family member 3 antibody
    • VICKZ3 antibody
    see all

Images

  • All lanes : Anti-IMP3 antibody (ab176685) at 0.04 µg/ml

    Lane 1 : HeLa lysate at 50 µg
    Lane 2 : HeLa lysate at 15 µg
    Lane 3 : Jurkat lysate at 50 µg
    Lane 4 : 293T lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 64 kDa


    Exposure time: 3 minutes
  • Detection of Human IMP3 by Western Blot of Immunoprecipitates.

    Detection of IMP3 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab176685 at 6 µg/mg lysate for IP. For WB analysis of immunoprecipitated IMP3, ab176685 was used at 1 µg/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab176685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up