Overview

  • Product nameAnti-IMPG2 antibody
  • Description
    Rabbit polyclonal to IMPG2
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 900-949 (

    VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL

    ) of Human IMPG2 (NP_057331).

  • Positive control
    • 293T cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesPurified by peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 139 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:62500.

Target

  • RelevanceIMPG2 (Interphotoreceptor matrix proteoglycan 2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye. IMPG2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.
  • Cellular localizationMembrane; Single pass type I membrane protein
  • Database links
  • Alternative names
    • Interphotoreceptor matrix proteoglycan 2 antibody
    • Interphotoreceptor matrix proteoglycan 200 antibody
    • Interphotoreceptor matrix proteoglycan of 200 kDa antibody
    • IPM 200 antibody
    • IPM200 antibody
    • Sialoprotein associated with cones and rods proteoglycan antibody
    • SPACRCAN antibody
    see all

Anti-IMPG2 antibody images

  • Anti-IMPG2 antibody (ab82813) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 139 kDa
    Observed band size : 139 kDa

References for Anti-IMPG2 antibody (ab82813)

ab82813 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"