Overview

  • Product nameAnti-INCA antibody
    See all INCA primary antibodies
  • Description
    Rabbit polyclonal to INCA
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 51-100 (

    MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT

    ) of Human INCA (NP_001007233).

  • Positive control
    • Jurkat Cell Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab113892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRegulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 CARD domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAR17_HUMAN antibody
    • CARD 17 antibody
    • CARD17 antibody
    • Caspase 1 inhibitor antibody
    • Caspase recruitment domain containing protein 17 antibody
    • Caspase recruitment domain-containing protein 17 antibody
    • Caspase-1 inhibitor INCA antibody
    • Caspase1 inhibitor antibody
    • Inhibitory caspase recruitment domain (CARD) protein antibody
    • Inhibitory caspase recruitment domain protein antibody
    see all

Anti-INCA antibody images

  • Anti-INCA antibody (ab113892) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 12 kDa

References for Anti-INCA antibody (ab113892)

ab113892 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"